- Recombinant Rat Heme transporter HRG1 (Slc48a1)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1228120
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 16,615 Da
- E Coli or Yeast
- 1-146
- solute carrier family 48 (heme transporter), member 1
- HRG-1, Hrg1
- Heme transporter HRG1 (Slc48a1)
Sequence
MAPTRLQLGVRAAYSGFSSLAGFSIFFVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYMQDYWRTWLRGLRGFFFVGALFSAVSFSAFCTFLTLAITQHQSFKDPNSYYLSCVWSFISFKWAFLLSLYAHRYRADFADISILSDF